PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0180300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 294aa    MW: 30637.2 Da    PI: 8.4825
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0180300genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.51.7e-3969129262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     +e+alkcprCdstntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  Spipo0G0180300  69 PEAALKCPRCDSTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 129
                     67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3153121IPR003851Zinc finger, Dof-type
PfamPF027017.9E-3372127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.67473127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MVFSSVPTYL DPPNWNQPQS GHHQRATGGG GGGGGAGGEA TQLPPTAGPS SARPCSMAER  60
ARLAKMAQPE AALKCPRCDS TNTKFCYFNN YSLTQPRHFC KTCRRYWTRG GALRNVPVGG  120
GCRRNKRSKS TGGGGGGSRN SGGSSAGGGG AITPSFQPPP QLPFMPPLQP LVDYELHFPL  180
DTVDFQLGGS GGVGLEQWRL QQVQQQFSLL TGMEPPAAAP PPPSASSAME LFPFDGELAS  240
VKMEDPQGLN LPRHYLGVPG SDQYWHGAGA GDMGNSGGIG GGGGWTDFQS NFL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009416134.11e-94PREDICTED: dof zinc finger protein DOF3.6-like
TrEMBLM0RF435e-75M0RF43_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P03660_0011e-74(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48932961
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.18e-46OBF-binding protein 3